DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and pi15a

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001153449.1 Gene:pi15a / 561978 ZFINID:ZDB-GENE-040724-135 Length:260 Species:Danio rerio


Alignment Length:176 Identity:47/176 - (26%)
Similarity:71/176 - (40%) Gaps:38/176 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LNEHNRLREKHGSPP-----LTLDDELTKGCEEYAKVLANNEKLEHSSSAGQNY-GENLCMRS-- 83
            |:.||::|.|...|.     :..||.|.|..|::|....    .||.......: |:||.:|:  
Zfish    73 LDYHNKVRGKVFPPASNMEYMVWDDTLAKTAEQWASTCI----WEHGPRNLLRFLGQNLSVRTGR 133

  Fly    84 -QTPLQCVQDWYDEIADYDFEKPQ----------FAMSTGHFTALVWKNAKKMG--IGQAKDKK- 134
             ::.||.|:.|:||:.||.|..|:          :.....|:|.:||..:.|:|  |....:.. 
Zfish   134 YRSILQLVKPWHDEVKDYSFPYPRDCNPRCPLKCYGPMCTHYTQMVWATSNKVGCAINTCHNMNV 198

  Fly   135 -GYYW-----VVARYYPPVNVNGQFEENV------LPPIKGEGDEN 168
             |..|     :|..|.|..|..|:....|      .||..|....|
Zfish   199 WGSVWKRATYLVCNYSPKGNWIGEAPYKVGVPCSMCPPSYGGSCSN 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 40/149 (27%)
pi15aNP_001153449.1 SCP_euk 71..214 CDD:240180 38/144 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.