DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and pi15b

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_684600.2 Gene:pi15b / 556658 ZFINID:ZDB-GENE-070912-590 Length:257 Species:Danio rerio


Alignment Length:177 Identity:45/177 - (25%)
Similarity:71/177 - (40%) Gaps:40/177 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LNEHNRLREKHGSPPLTL-----DDELTKGCEEYAKVLANNEKLEHSSSAGQNY-GENLCMRS-- 83
            |:.||::|.....|...:     ||.|.:..|.:|....    .||.......| |:||.:|:  
Zfish    70 LDYHNKVRANVFPPAANMEYMLWDDGLARSAEAWAATCI----WEHGPPYLLRYLGQNLSVRTGN 130

  Fly    84 -QTPLQCVQDWYDEIADYDFEKPQ----------FAMSTGHFTALVWKNAKKMG----------I 127
             ::.||.|:.||||:.||.|..|:          :.....|:|.:||.::.::|          :
Zfish   131 YRSILQLVKPWYDEVRDYMFPYPRDCNPHCPMRCYGPMCTHYTQMVWASSNRVGCAIQTCFNMVV 195

  Fly   128 GQAKDKKGYYWVVARYYPPVNVNGQFEENV------LPPIKGEGDEN 168
            ..|..::..| :|..|.|..|..|:....|      .||..|....|
Zfish   196 WGAVWREATY-LVCNYSPKGNWIGEAPYRVGVPCSACPPSYGGSCSN 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 38/150 (25%)
pi15bXP_684600.2 SCP_euk 68..211 CDD:240180 36/145 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.