DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and PI15

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001311332.1 Gene:PI15 / 51050 HGNCID:8946 Length:258 Species:Homo sapiens


Alignment Length:205 Identity:54/205 - (26%)
Similarity:81/205 - (39%) Gaps:59/205 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LNEHNRLREKHGSPPLTL-----DDELTKGCEEYAKVLANNEKLEHSSSAGQNY-----GENLCM 81
            |:.||::|.|...|...:     |:.|.|..|.:|....    .:|    |.:|     |:||.:
Human    71 LDYHNQVRGKVFPPAANMEYMVWDENLAKSAEAWAATCI----WDH----GPSYLLRFLGQNLSV 127

  Fly    82 RS---QTPLQCVQDWYDEIADYDFEKPQ----------FAMSTGHFTALVWKNAKKMGIG----Q 129
            |:   ::.||.|:.||||:.||.|..||          |.....|:|.:||..:.::|..    |
Human   128 RTGRYRSILQLVKPWYDEVKDYAFPYPQDCNPRCPMRCFGPMCTHYTQMVWATSNRIGCAIHTCQ 192

  Fly   130 AKDKKGYYW-----VVARYYPPVNVNGQFEENV------LPPIKGEGDENGQGNLNRFQVDNI-- 181
            ..:..|..|     :|..|.|..|..|:....|      .||..|       |:.    .||:  
Human   193 NMNVWGSVWRRAVYLVCNYAPKGNWIGEAPYKVGVPCSSCPPSYG-------GSC----TDNLCF 246

  Fly   182 PIIVMLWLCW 191
            |.:...:|.|
Human   247 PGVTSNYLYW 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 42/153 (27%)
PI15NP_001311332.1 CAP_PI15 67..212 CDD:349408 40/148 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.