DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and im:7150988

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_002667823.1 Gene:im:7150988 / 504039 ZFINID:ZDB-GENE-050309-169 Length:150 Species:Danio rerio


Alignment Length:145 Identity:51/145 - (35%)
Similarity:85/145 - (58%) Gaps:6/145 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ADLQEDHLNEHNRLREKHGSPPLTLDDELTKGCEEYAKVLANNEKLEHSSSA-GQN--YGENLCM 81
            |..:::.|..||:.|.:|.:|||...::|.:..:::|:.:.:.:.|.||.:. |:|  |..:...
Zfish     4 ASFKQEFLQTHNQYRHQHQAPPLVYREDLCRAAQKWAEHMLSKKSLGHSETENGENVYYSFSSVK 68

  Fly    82 RSQTPLQCVQDWYDEIADYDFEKPQFAMSTGHFTALVWKNAKKMGIGQAKDKKGYYWVVARYYPP 146
            ::.|..:.|..||.||.||:|.|......|||||.:|||::|::|:|.|.|....: ||.:|.|.
Zfish    69 KTPTGKEAVDSWYSEIKDYNFAKSGHQPKTGHFTQVVWKSSKELGVGLATDGNTVF-VVGQYKPA 132

  Fly   147 VNVN--GQFEENVLP 159
            .|:.  |.:|:||||
Zfish   133 GNITNAGYYEQNVLP 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 43/130 (33%)
im:7150988XP_002667823.1 SCP_GAPR-1_like 5..135 CDD:240182 43/130 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49417
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0001021
OrthoInspector 1 1.000 - - otm26149
orthoMCL 1 0.900 - - OOG6_101367
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.930

Return to query results.
Submit another query.