DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and Glipr1l1

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_002729836.2 Gene:Glipr1l1 / 503139 RGDID:1563000 Length:235 Species:Rattus norvegicus


Alignment Length:161 Identity:45/161 - (27%)
Similarity:64/161 - (39%) Gaps:23/161 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DLQEDHLNEHNRLREKHGSPPLTLDDELT--KGCEEYAKVLANNEKLEHSSSAGQNY-------- 75
            :.:...||.||..|.| ..||.:..::|:  |...:.||......|..|:....:.:        
  Rat    40 EFKNGFLNSHNEARRK-VQPPASNMNQLSWDKSLAKLAKSWTRECKFSHNPCTSKRHGCTKDYDY 103

  Fly    76 -GENLCMR--SQTPLQCVQDWYDEIADYDFEKPQFAMSTGHFTALVWKNAKKMG--IGQAKDKKG 135
             |||:.:.  ...|...|..||:|..||:|:......:.||:|.:||....|:|  |.......|
  Rat   104 IGENIYLGKIDARPEDVVFSWYNETKDYNFDDNTCTKTCGHYTQVVWAKTLKIGCAISNCPHLTG 168

  Fly   136 YY--WVVARYYPPVNVNGQFEENVLPPIKGE 164
            |.  ..|..|.|..|..|.     .|.||||
  Rat   169 YSAGLFVCNYVPAGNFQGS-----KPYIKGE 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 38/144 (26%)
Glipr1l1XP_002729836.2 SCP 40..181 CDD:294090 37/141 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.