DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and CLEC18B

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001011880.2 Gene:CLEC18B / 497190 HGNCID:33849 Length:455 Species:Homo sapiens


Alignment Length:196 Identity:47/196 - (23%)
Similarity:72/196 - (36%) Gaps:46/196 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LIVLALCLLVLVIADLQEDHLNE-------------------HNRLREKHGSPP------LTLDD 46
            |:.:.|.||....|::....|.|                   ||||| ....||      |...|
Human    13 LLAVLLALLGTTWAEVWPPQLQEQAPMAGALNRKESFLLLSLHNRLR-SWVQPPAADMRRLDWSD 76

  Fly    47 ELTKGCEEYAKV-------LANNEKLEHSSSAGQNYGENLCMRSQTPLQCVQDWYDEIADYDFEK 104
            .|.:..:..|.:       ||:.  |..:...|.|. :.|.....:.::.|..|:.|...|....
Human    77 SLAQLAQARAALCGIPTPSLASG--LWRTLQVGWNM-QLLPAGLASFVEVVSLWFAEGQRYSHAA 138

  Fly   105 PQFAMST--GHFTALVWKNAKKMGIGQAKDKKGYYWV---VARYYPPVN--VNGQFEENVLPPIK 162
            .:.|.:.  .|:|.|||..:.::|.|:.....|...:   |..|.|..|  |||   :.::|..|
Human   139 GECARNATCTHYTQLVWATSSQLGCGRHLCSAGQTAIEAFVCAYSPGGNWEVNG---KTIIPYKK 200

  Fly   163 G 163
            |
Human   201 G 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 36/166 (22%)
CLEC18BNP_001011880.2 SCP_euk 50..183 CDD:240180 31/136 (23%)
CLECT 310..443 CDD:153057
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.