DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and glipr2l

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001005978.1 Gene:glipr2l / 449805 ZFINID:ZDB-GENE-041010-53 Length:154 Species:Danio rerio


Alignment Length:143 Identity:66/143 - (46%)
Similarity:86/143 - (60%) Gaps:7/143 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EDHLNEHNRLREKHGSPPLTLDDELTKGCEEYAKVLANNEKLEHS--SSAGQNYGENLCMRS--Q 84
            |:.|..||..|.||.:|||.|..:|......||:.||:...|:||  ||.| |.||||...|  |
Zfish    11 EEALKTHNEYRRKHQAPPLKLSSKLCSEASRYAESLASTRILKHSVESSRG-NCGENLAWASYDQ 74

  Fly    85 TPLQCVQDWYDEIADYDFEKPQFAMSTGHFTALVWKNAKKMGIGQAKDKKGYYWVVARYYPPVNV 149
            |.......||:|:..|:|.:|.|:..||||||:|||.:||:|:|:|....|..:|||||:|..|:
Zfish    75 TGKDVTDRWYNEVNQYNFNQPGFSSGTGHFTAVVWKGSKKLGVGKAVASDGSTFVVARYFPAGNI 139

  Fly   150 --NGQFEENVLPP 160
              .|.|:.|||||
Zfish   140 TNQGHFQANVLPP 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 58/128 (45%)
glipr2lNP_001005978.1 SCP_GAPR-1_like 9..139 CDD:240182 58/128 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592784
Domainoid 1 1.000 97 1.000 Domainoid score I7236
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 121 1.000 Inparanoid score I4727
OMA 1 1.010 - - QHG49417
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0001021
OrthoInspector 1 1.000 - - otm26149
orthoMCL 1 0.900 - - OOG6_101367
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2242
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.