DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and Ag5r

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001245671.1 Gene:Ag5r / 44631 FlyBaseID:FBgn0015010 Length:256 Species:Drosophila melanogaster


Alignment Length:109 Identity:30/109 - (27%)
Similarity:42/109 - (38%) Gaps:30/109 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 HSSSAGQNYGENLC-MRSQTPLQC-------VQDWYDE--------IADY--DFEKPQFAMSTGH 113
            |::.|....|:||. |....||..       |..||||        |..|  ::..|    :.||
  Fly   115 HNTDAFDWSGQNLAWMGYYNPLNVTHYLEWGVDMWYDEAVYTKQAYIDAYPSNYNGP----AIGH 175

  Fly   114 FTALVWKNAKKMGIGQA------KDKKGYYWVVARYYPPVNVNG 151
            ||.||.....::|...|      :..|.:  ::|..|...||.|
  Fly   176 FTVLVADRNTEVGCAAATYSVSGQSYKAF--LLACNYAATNVLG 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 27/105 (26%)
Ag5rNP_001245671.1 SCP_euk 59..211 CDD:240180 26/101 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455020
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.