DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and scpr-C

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001287282.1 Gene:scpr-C / 41348 FlyBaseID:FBgn0037879 Length:262 Species:Drosophila melanogaster


Alignment Length:209 Identity:40/209 - (19%)
Similarity:73/209 - (34%) Gaps:74/209 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DLQEDHLNEHNRLREKHGSPPLTLDDELTKG--------------------CEEYAKVLANNEK- 64
            |::|..:..|::|       .|.|.:||...                    |||.:.:...|.| 
  Fly    47 DVREVKIEPHHKL-------ILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKT 104

  Fly    65 ----------LEHSSSAGQN------------YGENLCMRSQTPLQCVQDWYDE--------IAD 99
                      .|..:.||||            |.:...::.|     :::|:.|        :|.
  Fly   105 CESLPDKCRSTERFAYAGQNNAVFQYSGAETEYTDAEIIKEQ-----IENWFAERSNASPEILAS 164

  Fly   100 YDFEKPQFAMSTGHFTALVWKNAKKMGIGQAKDKKGYY--WVVARYYPPVNVNGQFEENVLPPIK 162
            :..|.|..|::  .||..|.:....:|....:..:.:|  :|:...:...|:.||       |:.
  Fly   165 FPEELPNKAVT--KFTIAVAEKNTHVGCAAVRFSRDFYNHFVLTCNFATSNIVGQ-------PVY 220

  Fly   163 GEGDENGQGNLNRF 176
            ..|::...|..||:
  Fly   221 TPGEKATTGCKNRY 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 32/180 (18%)
scpr-CNP_001287282.1 SCP_euk 58..210 CDD:240180 29/165 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455012
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.