DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and CG11977

DIOPT Version :10

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_649855.3 Gene:CG11977 / 41076 FlyBaseID:FBgn0037650 Length:274 Species:Drosophila melanogaster


Alignment Length:155 Identity:32/155 - (20%)
Similarity:59/155 - (38%) Gaps:47/155 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IADLQEDHLNEHNRLREK----HGSPP-------LTLDDELTKGCEEYAKVLA---NNEKLEHSS 69
            ::|.:.|.:...|..|.|    .|:.|       :..||||:        |:|   :|:.|:|:.
  Fly    77 MSDYRYDIVRNVNNFRRKLEWGLGNLPRAVKFKNIKWDDELS--------VMAMRVSNQCLQHTF 133

  Fly    70 SAGQN------YGENL-------CMRSQTPLQCVQDWYDEIADYDFEKPQFAMSTGH-------- 113
            |...|      .||:.       ..:....:..:..|::.   :...||.:..:..:        
  Fly   134 SPCVNTFLYKDVGESSDFVKVQNTSKGFNVISFLNMWFEY---HKMMKPSYVNNFPNIAPQDRLI 195

  Fly   114 -FTALVWKNAKKMGIGQAKDKKGYY 137
             |..|:::..||||.|..|..:|.:
  Fly   196 IFANLIYEKNKKMGCGMVKSGQGRF 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 CAP_GAPR1-like 21..149 CDD:349401 32/153 (21%)
CG11977NP_649855.3 CAP_euk 81..226 CDD:349399 31/151 (21%)

Return to query results.
Submit another query.