DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and crispld1b

DIOPT Version :10

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_956764.2 Gene:crispld1b / 393442 ZFINID:ZDB-GENE-040426-1204 Length:509 Species:Danio rerio


Alignment Length:177 Identity:50/177 - (28%)
Similarity:69/177 - (38%) Gaps:40/177 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LNEHNRLREKHGSPP-----LTLDDELTKGCEEYAKVLANNEKLEHSSS-----AGQNYGENLCM 81
            |:.||:||.:...|.     :..|.||.:..|.:|....    .||..|     .|||.|.: ..
Zfish    67 LDLHNKLRGQVYPPASNMEYMVWDTELERSAEHWAHTCL----WEHGPSHLLTRIGQNLGAH-WG 126

  Fly    82 RSQTPLQCVQDWYDEIADYDFEKPQ-------FAMS---TGHFTALVWKNAKKMG----IGQAKD 132
            |.:.|...||.||||:.|:.:..||       :..|   ..|:|.|||..:.|:|    :....:
Zfish   127 RDRPPTFHVQAWYDEVRDFSYPYPQECNPHCPYRCSGPVCTHYTQLVWATSNKIGCAINVCYNMN 191

  Fly   133 KKGYYW-----VVARYYPPVNVNGQFEE------NVLPPIKGEGDEN 168
            ..|..|     :|..|.||.|..|....      :..||..|.|..|
Zfish   192 VWGMIWAKAVYLVCNYSPPGNWWGHAPYKHGTPCSACPPSYGGGCRN 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 CAP_GAPR1-like 21..149 CDD:349401 43/150 (29%)
crispld1bNP_956764.2 None

Return to query results.
Submit another query.