DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and CG6628

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster


Alignment Length:147 Identity:33/147 - (22%)
Similarity:54/147 - (36%) Gaps:31/147 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IADLQEDHLNEHNRLREKHGSPP---LTLDDELT--KGCEEYAKVLANNEK---LEHSSSAG--- 72
            :..||:..|.|||.||....|..   |...|.:.  :...|.|.:...|.|   |:|.|...   
  Fly    65 LTGLQDLILGEHNALRNVLASGKIINLPKPDRMATLQWHSELADLATLNVKQCVLQHDSCHNTPD 129

  Fly    73 -QNYGENLCMRSQTPL--------QC-----VQDWYDEIADYD------FEKPQFAMSTGHFTAL 117
             .|.|:||.:.:.|.|        :|     :..|:::..:..      |.|.:...|..:|..:
  Fly   130 FHNSGQNLALVNITLLPEDGNHTDECLVKESIGGWWNQSINITKEQLQRFPKGKLGDSIRNFAVM 194

  Fly   118 VWKNAKKMGIGQAKDKK 134
            ...|...:|....:.:|
  Fly   195 ARDNNTHVGCAALRFEK 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 33/145 (23%)
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 32/143 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455021
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.