DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and CG34002

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster


Alignment Length:199 Identity:41/199 - (20%)
Similarity:63/199 - (31%) Gaps:76/199 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LNEHNRLR------EKHGSP------PLTLDDE-------LTKGC-----------EEYAK---- 57
            ||.||..|      :.|..|      .|..|.|       |.|.|           ||::.    
  Fly    73 LNHHNTYRDIVAGGQMHRLPIAARMLKLKWDHELALLATILVKRCDLQPTDHCISTEEFSSPSYH 137

  Fly    58 VLANNEKLEHSSSAGQNYGENLCMRSQTPLQCVQDWYDEIADYDFEKPQFAMST-----GHFTAL 117
            .:.|..|.:..:..        .:|||     :..|||:............:||     |||..:
  Fly   138 AVYNKFKAKEDTFR--------IVRSQ-----LNAWYDQYKHVSSSSLIDGLSTAKKEIGHFLRM 189

  Fly   118 VWKNAKKMGIGQAKDKKG---YYWVVARY-------------------YPPVNVNGQFEE--NVL 158
            :...:.::|...|..:||   :.|:...|                   |....:||:|:.  |..
  Fly   190 IVGPSNRLGCAIASIEKGGWTHQWLACLYSCSPQKNSLLYEYSGKPGVYCTTGINGKFQNLCNDT 254

  Fly   159 PPIK 162
            .|:|
  Fly   255 EPVK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 35/182 (19%)
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 33/158 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454999
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.