DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and CG34049

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster


Alignment Length:136 Identity:56/136 - (41%)
Similarity:81/136 - (59%) Gaps:6/136 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LNEHNRLREKHGSPPLTLDDELTKGCEEYAKVLANNEKLEHSSSAGQNYGENL--CMRSQTPL-Q 88
            |.|.|:.|..|.:.||.:|::|....:|:|..||:..|||  :.....||||:  ..||:..: |
  Fly   150 LRETNKYRRLHNANPLKMDEKLCSYAQEWADHLADLNKLE--TRPNPLYGENIMRVRRSKFSVDQ 212

  Fly    89 CVQDWYDEIADYDFEKPQFAMSTGHFTALVWKNAKKMGIGQAKDKKGYYWVVARYYPPVNVNGQF 153
            .::.||.|..:||:.||.|.:.|||||.|||:.::.:|:|.|.|... .|:|..|:||.||:..|
  Fly   213 ILKLWYQEKYNYDYLKPGFNLYTGHFTQLVWRESEFLGVGVACDVSS-IWIVCNYHPPGNVSEHF 276

  Fly   154 EENVLP 159
            .|||||
  Fly   277 RENVLP 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 48/124 (39%)
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 48/124 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455001
Domainoid 1 1.000 77 1.000 Domainoid score I3078
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0001021
OrthoInspector 1 1.000 - - otm3540
orthoMCL 1 0.900 - - OOG6_101367
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.750

Return to query results.
Submit another query.