DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and Glipr2

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_081726.1 Gene:Glipr2 / 384009 MGIID:1917770 Length:154 Species:Mus musculus


Alignment Length:142 Identity:68/142 - (47%)
Similarity:87/142 - (61%) Gaps:7/142 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LNEHNRLREKHGSPPLTLDDELTKGCEEYAKVLANNEKLEHS--SSAGQNYGENLCMRS--QTPL 87
            |..||..|.:||.|||.|..:|.:..::|::.||:...|:||  ||.|| .||||...|  ||..
Mouse    14 LKAHNEYRAQHGVPPLKLCKKLNREAQQYSEALASTRILKHSPESSRGQ-CGENLAWASYDQTGK 77

  Fly    88 QCVQDWYDEIADYDFEKPQFAMSTGHFTALVWKNAKKMGIGQAKDKKGYYWVVARYYPPVNV--N 150
            .....||.||..|:|::|.|...||||||:||||.||:|:|:|....|..:|||||:|..|:  .
Mouse    78 DVADRWYSEIKSYNFQQPGFTSGTGHFTAMVWKNTKKIGVGKASASDGSSFVVARYFPAGNIVNQ 142

  Fly   151 GQFEENVLPPIK 162
            |.|||||.||.|
Mouse   143 GFFEENVPPPKK 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 58/125 (46%)
Glipr2NP_081726.1 CAP_GAPR1-like 8..139 CDD:349401 58/125 (46%)
Interaction with CAV1. /evidence=ECO:0000250 91..98 2/6 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847496
Domainoid 1 1.000 101 1.000 Domainoid score I6978
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 124 1.000 Inparanoid score I4704
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49417
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0001021
OrthoInspector 1 1.000 - - oto94278
orthoMCL 1 0.900 - - OOG6_101367
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2242
SonicParanoid 1 1.000 - - X35
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.800

Return to query results.
Submit another query.