DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and CG9822

DIOPT Version :10

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_611581.1 Gene:CG9822 / 37440 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster


Alignment Length:40 Identity:12/40 - (30%)
Similarity:22/40 - (55%) Gaps:1/40 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 IEVMEGDIAQTLGLVTV-GDVHKIYDDICDIINKHRERPK 135
            |.|.||::.:....||| ||:|..:.|:.::.....:.|:
  Fly    35 ILVEEGNVQRVDSPVTVCGDIHGQFYDLKELFKVGGDVPE 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 CAP_GAPR1-like 21..149 CDD:349401 12/40 (30%)
CG9822NP_611581.1 CAP_euk 64..219 CDD:349399 1/11 (9%)

Return to query results.
Submit another query.