DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and Clec18a

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_030099497.1 Gene:Clec18a / 353287 MGIID:2672935 Length:615 Species:Mus musculus


Alignment Length:211 Identity:48/211 - (22%)
Similarity:73/211 - (34%) Gaps:76/211 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LIVLALCLLVLVIADLQEDH------------------LNEHNRLREK-HGSPPLTLDDELTKGC 52
            |::|.|.||.:...::|...                  |..|||||.: |  ||           
Mouse    93 LLLLLLSLLGITWTEVQPPQPKQDPTLQALSRKESFLILTAHNRLRSRVH--PP----------- 144

  Fly    53 EEYAKVLANNEKLEHSSSAGQ--NYGENLCMRSQTP--------------------------LQC 89
                  .||.::::.|.|..|  .....||:.|.||                          ::.
Mouse   145 ------AANMQRMDWSESLAQLAEARAALCVTSVTPNLASTPGHNSHVGWNVQLMPMGSASFVEV 203

  Fly    90 VQDWYDEIADYDFEKPQFA--MSTGHFTALVWKNAKKMGIGQAK---DKKGYYWVVARYYPPVN- 148
            |..|:.|...|.....:.|  .:..|:|.|||..:.::|.|:..   |::.....|..|.|..| 
Mouse   204 VNLWFAEGLQYRHGDAECAHNATCAHYTQLVWATSSQLGCGRQPCFVDQEAMEAFVCAYSPGGNW 268

  Fly   149 -VNGQFEENVLPPIKG 163
             :||   :.|.|..||
Mouse   269 DING---KTVAPYKKG 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 37/181 (20%)
Clec18aXP_030099497.1 CAP_euk 129..263 CDD:349399 33/152 (22%)
EGF_Lam 315..360 CDD:214543
CLECT 390..514 CDD:153057
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.