DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and CG10651

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster


Alignment Length:67 Identity:17/67 - (25%)
Similarity:27/67 - (40%) Gaps:10/67 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 ELTKGCEEYAKVLANNEKLEHSSSAGQNYGENLCMRSQTPLQCVQDWYDEIA--DYDFEKPQFAM 109
            |..||..:..|.|.:.::|..:.:.|..:.|        |.....|..:|..  ||:||...|.:
  Fly   234 ECMKGSNKQYKNLCHKDELVKTCNGGSLFVE--------PENDYNDGQEENMENDYEFETTVFTL 290

  Fly   110 ST 111
            .|
  Fly   291 PT 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 17/67 (25%)
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455025
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.