powered by:
Protein Alignment CG31482 and CG10651
DIOPT Version :9
Sequence 1: | NP_731097.1 |
Gene: | CG31482 / 40806 |
FlyBaseID: | FBgn0051482 |
Length: | 195 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001286095.1 |
Gene: | CG10651 / 35303 |
FlyBaseID: | FBgn0032853 |
Length: | 316 |
Species: | Drosophila melanogaster |
Alignment Length: | 67 |
Identity: | 17/67 - (25%) |
Similarity: | 27/67 - (40%) |
Gaps: | 10/67 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 47 ELTKGCEEYAKVLANNEKLEHSSSAGQNYGENLCMRSQTPLQCVQDWYDEIA--DYDFEKPQFAM 109
|..||..:..|.|.:.::|..:.:.|..:.| |.....|..:|.. ||:||...|.:
Fly 234 ECMKGSNKQYKNLCHKDELVKTCNGGSLFVE--------PENDYNDGQEENMENDYEFETTVFTL 290
Fly 110 ST 111
.|
Fly 291 PT 292
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG31482 | NP_731097.1 |
SCP_GAPR-1_like |
21..149 |
CDD:240182 |
17/67 (25%) |
CG10651 | NP_001286095.1 |
SCP_euk |
61..210 |
CDD:240180 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45455025 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2340 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1528782at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR10334 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.940 |
|
Return to query results.
Submit another query.