DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and CG4270

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster


Alignment Length:138 Identity:54/138 - (39%)
Similarity:74/138 - (53%) Gaps:12/138 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 NEHNRLREKHGSPPLTLDDELTKGCEEYAKVLANNEKLEHSSSAGQNYGENLCM------RSQTP 86
            |..|:.|..||.|.:|::..|.|..:|:|..|.:...:.|..:  ..||||:.:      ....|
  Fly    37 NTTNKYRAMHGCPAVTINAALNKLAQEWANHLRDQNTMAHRPN--PKYGENIFLSGGMDVTGDLP 99

  Fly    87 LQCVQDWYDEIADYDFEKPQFAMSTGHFTALVWKNAKKMGIGQAKDKKGYYWVVARYYPPVNVNG 151
               |:.||.||..|||.|.||..:.||||.|:||::.:||.|.|: |....|||..|.||.||.|
  Fly   100 ---VEMWYREINSYDFNKAQFVPTAGHFTQLIWKSSVEMGSGVAR-KADRTWVVCNYNPPGNVVG 160

  Fly   152 QFEENVLP 159
            .|::||.|
  Fly   161 LFKDNVPP 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 47/126 (37%)
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 47/126 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455002
Domainoid 1 1.000 77 1.000 Domainoid score I3078
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I2214
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0001021
OrthoInspector 1 1.000 - - otm26149
orthoMCL 1 0.900 - - OOG6_101367
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2242
SonicParanoid 1 1.000 - - X35
1211.830

Return to query results.
Submit another query.