DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and glipr2

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_021327299.1 Gene:glipr2 / 325699 ZFINID:ZDB-GENE-030131-4424 Length:543 Species:Danio rerio


Alignment Length:182 Identity:65/182 - (35%)
Similarity:100/182 - (54%) Gaps:25/182 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 QEDHLNEHNRLREKHGSPPLTLDDELTKGCEEYAKVLANNEKLEHSSSAGQNYGENL------CM 81
            :.:.|..||..|::||:||||.:..|.:..:::|:.|.:.:.|.||:   :.|||||      ..
Zfish     7 EAEFLQVHNAYRKQHGAPPLTFNKNLCRSAQQWAEHLLSTKTLAHSN---KGYGENLYYAWSSAN 68

  Fly    82 RSQTPLQCVQDWYDEIADYDFEKPQFAMSTGHFTALVWKNAKKMGIGQAKDKKGYYWVVARYYPP 146
            :..|..:.|..||.||.||:|.:|.|:..|||||.:|||:.|::|:|.|.|....: ||.:|.|.
Zfish    69 KKLTGNEAVDSWYGEIKDYNFSRPGFSSKTGHFTQVVWKDTKELGVGLATDGNTIF-VVGQYLPA 132

  Fly   147 VNV--NGQFEENVLP--------PI----KGEGDENGQGNLNRFQVDNIPII 184
            .|:  .|.||:||||        |.    ||| ..:|...::..:|.::|.|
Zfish   133 GNIANAGYFEKNVLPTGSKLDQKPTGATHKGE-QAHGSSGIHSNKVPSVPHI 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 49/131 (37%)
glipr2XP_021327299.1 SCP_GAPR-1_like 5..135 CDD:240182 49/131 (37%)
SCP_GAPR-1_like 196..326 CDD:240182
SCP_GAPR-1_like 397..528 CDD:240182
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0001021
OrthoInspector 1 1.000 - - otm26149
orthoMCL 1 0.900 - - OOG6_101367
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2242
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.810

Return to query results.
Submit another query.