DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and CG9400

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster


Alignment Length:207 Identity:47/207 - (22%)
Similarity:67/207 - (32%) Gaps:57/207 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LNEHNRLREKHGS------------PPLTLDDELTKGCEEYAKVLANNEKLEHSSS--------A 71
            |:.||..|.|..|            |.|..|.||    |:.|.:.|...:..|...        :
  Fly   100 LDMHNLARSKIASGNLDGYRSAAHMPLLRWDTEL----EQMAALHAKRCQFAHDKCRNTPRFKFS 160

  Fly    72 GQN-----YGENLCMRSQTPLQCVQDWYDEIADYD-------FEKPQFAMSTGHFTALVWKNAKK 124
            |||     .|......|:.....|.:|:.|..|.:       ...|| ....||||.||.....:
  Fly   161 GQNIGYFWIGREFKSHSRRMKSFVINWFREHQDANQSFIDRYHPHPQ-GKKIGHFTLLVSDRVNR 224

  Fly   125 MGIG-----QAKDKKGYYWVVARYYPPVNVNGQFEENVLPPIKGEGDENGQGNLNRFQVDNIPII 184
            :|..     :.|..:..:.:...|    :.|..|.|    ||...|....:...:|.. :..|. 
  Fly   225 VGCAGVRFLEPKSNRFQFMLTCNY----DYNNIFNE----PIYQSGPAGSKCPQHRIS-EKFPS- 279

  Fly   185 VMLWLC-WQFTN 195
                || |:..|
  Fly   280 ----LCDWRDAN 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 35/158 (22%)
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 35/157 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455023
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
44.040

Return to query results.
Submit another query.