DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and CG31286

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_731103.1 Gene:CG31286 / 318662 FlyBaseID:FBgn0051286 Length:205 Species:Drosophila melanogaster


Alignment Length:212 Identity:63/212 - (29%)
Similarity:107/212 - (50%) Gaps:28/212 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFLVNILIVLALCLLVLVIADLQEDH------LNEHNRLREKHGSPPLTLDDELTKGCEEYAKVL 59
            |.|:..|:::.|..:.....:...:|      |.|.|:.|::||.|.||||:.|:|||:.||..|
  Fly     1 MLLIRSLVIVFLVAISEFDRNFAINHDNAGIVLREINKRRDRHGVPKLTLDNVLSKGCQSYAWKL 65

  Fly    60 ANNEKLEHSSSAGQNYGENLC---MRSQTPLQCVQDWYDEIADYDFEKPQFAMSTGHFTALVWKN 121
            :.:..|.:|....::|.|::|   ::.....:||::||:. ..:|...|:    ...|||::|::
  Fly    66 SKSATLNYSDPTNKDYTESICRFEVKRGALSRCVKNWYNG-RKFDILDPK----AKDFTAMIWRS 125

  Fly   122 AKKMGIGQAKDK--KGYYWVVARYYPPVNVNGQFEENVLPPIKGEGD----ENGQGNLNRFQVDN 180
            :..:|.|.|...  :|.:  |.||.||.||.|.:.:|| ||.|.:..    ||.|......:.||
  Fly   126 SVSLGYGDANINALQGVF--VVRYTPPGNVKGLYTDNV-PPRKRKQKKKKRENKQKEDCASRQDN 187

  Fly   181 -----IPIIVMLWLCWQ 192
                 :.|:.::...||
  Fly   188 RYVLLLSILSLVSTNWQ 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 43/138 (31%)
CG31286NP_731103.1 SCP 27..153 CDD:294090 42/132 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455003
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0001021
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.