DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and CG32679

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster


Alignment Length:113 Identity:28/113 - (24%)
Similarity:43/113 - (38%) Gaps:30/113 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 AKVLANNE---KLEHSSSAGQN----YGENLCMRSQTPL-------QCVQDWYDEIADY---DFE 103
            |::.|.|.   ::.|......|    .|:||.:.....:       |.:..|:||..|.   |.|
  Fly    99 AQLAAYNALQCRMAHDECRNTNTYRYAGQNLSILFTRSVDVAVFLRQRIAAWFDENRDATSGDME 163

  Fly   104 KPQF--AMSTGHFTALVWKNAKKMGIGQAKDKKGYYWVVARYYPPVNV 149
            ..|.  ..:.||||.:|  |.:...:|.|         :||:....||
  Fly   164 DYQMRGGPAIGHFTTMV--NERNNRVGCA---------IARFTDANNV 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 26/111 (23%)
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 28/113 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455006
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2242
SonicParanoid 1 1.000 - - X35
65.970

Return to query results.
Submit another query.