DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and Pi15

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001100387.1 Gene:Pi15 / 301489 RGDID:1309577 Length:258 Species:Rattus norvegicus


Alignment Length:205 Identity:53/205 - (25%)
Similarity:79/205 - (38%) Gaps:59/205 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LNEHNRLREKHGSPPLTL-----DDELTKGCEEYAKVLANNEKLEHSSSAGQNY-----GENLCM 81
            |:.||::|.|...|...:     |:.|.|..|.:|....    .:|    |.:|     |:||.:
  Rat    71 LDYHNQVRGKVFPPAANMEYMVWDENLAKSAEAWAATCI----WDH----GPSYLLRFLGQNLSV 127

  Fly    82 RS---QTPLQCVQDWYDEIADYDFEKPQ----------FAMSTGHFTALVWKNAKKMGIG----Q 129
            |:   ::.||.|:.||||:.||.|..||          |.....|:|.:||..:.::|..    |
  Rat   128 RTGRYRSILQLVKPWYDEVKDYAFPYPQDCNPRCPMRCFGPMCTHYTQMVWATSNRIGCAIHTCQ 192

  Fly   130 AKDKKGYYW-----VVARYYPPVNVNGQFEENV------LPPIKGEGDENGQGNLNRFQVDNI-- 181
            ..:..|..|     :|..|.|..|..|:....|      .||..|..           ..||:  
  Rat   193 NMNVWGSVWRRAVYLVCNYAPKGNWIGEAPYKVGVPCSSCPPSYGGA-----------CTDNLCF 246

  Fly   182 PIIVMLWLCW 191
            |.:...:|.|
  Rat   247 PGVTTNYLYW 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 42/153 (27%)
Pi15NP_001100387.1 SCP_euk 69..212 CDD:240180 40/148 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.