DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and Glipr1

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001011987.1 Gene:Glipr1 / 299783 RGDID:1305978 Length:251 Species:Rattus norvegicus


Alignment Length:142 Identity:36/142 - (25%)
Similarity:63/142 - (44%) Gaps:18/142 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DLQEDHLNEHNRLREKHGSPP------LTLDDELTKGCEEYAK--VLANNEKLE---HSSSAGQN 74
            |..|:.:..||..|.| ..||      ::.|.:|.:..:.:|:  |..:|.:|.   |.:..|  
  Rat    32 DFIEECVEVHNHFRSK-AYPPAGNMLYMSWDPKLAQIAKAWAQSCVFQHNPQLHSRIHPNFTG-- 93

  Fly    75 YGENLCMRSQTPLQ---CVQDWYDEIADYDFEKPQFAMSTGHFTALVWKNAKKMGIGQAKDKKGY 136
            .|||:.:.|.:...   .:..|::|...|||...:.....||:|.:||.::.|:|.......:|.
  Rat    94 LGENIWLGSLSLFSVRAAILAWFEESQYYDFSTGKCKKVCGHYTQIVWADSYKIGCAVQLCPRGA 158

  Fly   137 YWVVARYYPPVN 148
            .: :..|.|..|
  Rat   159 NF-ICNYGPAGN 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 36/142 (25%)
Glipr1NP_001011987.1 CAP 32..168 CDD:412178 35/139 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.