DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and Pi16

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001163952.1 Gene:Pi16 / 294312 RGDID:1304760 Length:483 Species:Rattus norvegicus


Alignment Length:181 Identity:52/181 - (28%)
Similarity:77/181 - (42%) Gaps:49/181 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LIVLALCLLVLVIAD-----LQEDH----LNEHNRLREKHGSPP------LTLDDELTKGCEEYA 56
            |.:|.|.||:|:.|.     |.||.    :..||..|.: .|||      :..||||.    .:|
  Rat    14 LPLLLLLLLLLLTATGPATALTEDEKQTMVELHNHYRAQ-VSPPASDMLQMRWDDELA----AFA 73

  Fly    57 KVLANNEKLEHSSSAGQNYGENLCMRS----QTPLQCVQDWYDEIADYDFEKPQFAMST------ 111
            |..|......|:...|:. ||||...:    ..|| .|.:|::|...|:       :||      
  Rat    74 KAYAQKCVWGHNKERGRR-GENLFAITDEGMDVPL-AVGNWHEEHEYYN-------LSTATCDPG 129

  Fly   112 ---GHFTALVWKNAKKMGIG-------QAKDKKGYYWVVARYYPPVNVNGQ 152
               ||:|.:||...:::|.|       |..::...:.:|..|.||.||.|:
  Rat   130 QMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGR 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 42/162 (26%)
Pi16NP_001163952.1 SCP_HrTT-1 39..172 CDD:240186 36/146 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.