DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and CLEC18C

DIOPT Version :10

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_775890.2 Gene:CLEC18C / 283971 HGNCID:28538 Length:446 Species:Homo sapiens


Alignment Length:196 Identity:47/196 - (23%)
Similarity:72/196 - (36%) Gaps:46/196 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LIVLALCLLVLVIADLQEDHLNE-------------------HNRLREKHGSPP------LTLDD 46
            |:.:.|.||....|::....|.|                   ||||| ....||      |...|
Human    13 LLAVLLALLGTAWAEVWPPQLQEQAPMAGALNRKESFLLLSLHNRLR-SWVQPPAADMRRLDWSD 76

  Fly    47 ELTKGCEEYAKV-------LANNEKLEHSSSAGQNYGENLCMRSQTPLQCVQDWYDEIADYDFEK 104
            .|.:..:..|.:       ||:.  |..:...|.|. :.|.....:.::.|..|:.|...|....
Human    77 SLAQLAQARAALCGIPTPSLASG--LWRTLQVGWNM-QLLPAGLASFVEVVSLWFAEGQRYSHAA 138

  Fly   105 PQFAMST--GHFTALVWKNAKKMGIGQAKDKKGYYWV---VARYYPPVN--VNGQFEENVLPPIK 162
            .:.|.:.  .|:|.|||..:.::|.|:.....|...:   |..|.|..|  |||   :.::|..|
Human   139 GECARNATCTHYTQLVWATSSQLGCGRHLCSAGQAAIEAFVCAYSPRGNWEVNG---KTIVPYKK 200

  Fly   163 G 163
            |
Human   201 G 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 CAP_GAPR1-like 21..149 CDD:349401 36/166 (22%)
CLEC18CNP_775890.2 CAP_euk 50..183 CDD:349399 31/136 (23%)
CLECT 310..434 CDD:153057
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.