DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and CG30486

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster


Alignment Length:126 Identity:28/126 - (22%)
Similarity:49/126 - (38%) Gaps:27/126 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IADLQEDHLNEHNRLREKHGSPPLTLDDELT-------KGCEEYAKVLANNEKLEHSSSAGQNYG 76
            :|..|..||...:|:      ..|...:||.       :.|:......:|.::..:.|..   ||
  Fly    75 VAKGQYPHLRPASRM------ATLRWHEELAGLAKFALRRCDYIDDYCSNTDEFSYVSYI---YG 130

  Fly    77 ENLCMR-SQTPLQ----CVQDWYDEI-----ADYDFEKP-QFAMSTGHFTALVWKNAKKMG 126
            ....:: .:.|:.    .:|.|.|::     |..:.||| :.....|:||.||...|..:|
  Fly   131 STKWLQLEKDPISVLDFVLQFWMDDVKGCTMAHINAEKPAKDGQCRGYFTQLVQDLAAHVG 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 27/124 (22%)
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 28/126 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455024
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.