DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and D2062.1

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001293506.1 Gene:D2062.1 / 24104374 WormBaseID:WBGene00017055 Length:204 Species:Caenorhabditis elegans


Alignment Length:163 Identity:51/163 - (31%)
Similarity:78/163 - (47%) Gaps:25/163 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IADLQEDHLNEHNRLREKHGSPPLTLDDELTKGCEEYAKVLANNEKLEHSSSAGQNYGENLCMRS 83
            |..|:|..:..||..|.|||:|||..|..:....:.:|..:|.:..:.|...  :.||||:.|..
 Worm    44 IPKLKELIVAYHNLYRSKHGAPPLVADPVMDVAAKRWADEMAKSGWISHEKP--RKYGENVAMFC 106

  Fly    84 QT---PL------QCVQDWYDEIADYDFE--KPQFAMSTGHFTALVWKNAKKMGIGQAKDKKG-- 135
            |:   ||      ..|..:|.|...||:.  ||:.....||||.:|||:::|:|:|.:..|..  
 Worm   107 QSGCWPLPQTLAQAMVHLFYIEGIGYDYSSFKPELLKENGHFTQIVWKSSRKIGVGISIGKSSQP 171

  Fly   136 ------YYWVVARYYPPVNVNGQ--FEENVLPP 160
                  ::.|  ::.||.||..|  :..||..|
 Worm   172 PYIPTMFHCV--KFDPPGNVLAQQYYLSNVQRP 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 44/146 (30%)
D2062.1NP_001293506.1 CAP_GAPR1-like 46..189 CDD:349401 44/146 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49417
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4761
orthoMCL 1 0.900 - - OOG6_101367
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.830

Return to query results.
Submit another query.