DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and scl-12

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_504056.1 Gene:scl-12 / 186714 WormBaseID:WBGene00019178 Length:208 Species:Caenorhabditis elegans


Alignment Length:152 Identity:37/152 - (24%)
Similarity:52/152 - (34%) Gaps:37/152 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LIVLALCLLVLVIADLQEDHLNEHNRLR--------EKHGS--PP------LTLDDELTKGCEEY 55
            ||.:..|......:..|...:..||.||        :..|:  ||      :..|..:....::|
 Worm     7 LIAIFGCATAQFSSTAQTAIVKAHNDLRSAIALGNYDAAGTIEPPAANMRKIKWDSTVASSAQQY 71

  Fly    56 AKVLANNEKLEHSSSAGQNYGENL--CMRSQTP-------LQCVQDWYDEIADYDFEKPQ----- 106
            |....:    :||   |..|||||  ...|..|       :.....|..|..||.:|...     
 Worm    72 ANTCPD----DHS---GTEYGENLYWSWSSSAPTSLDKFGVAASNSWEKEFQDYGWESTYMDADL 129

  Fly   107 FAMSTGHFTALVWKNAKKMGIG 128
            |....||.|.:.|....|:|.|
 Worm   130 FDSGIGHATQMAWAETNKIGCG 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 34/138 (25%)
scl-12NP_504056.1 SCP 21..175 CDD:214553 34/138 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.