powered by:
Protein Alignment CG31482 and F58E2.5
DIOPT Version :9
Sequence 1: | NP_731097.1 |
Gene: | CG31482 / 40806 |
FlyBaseID: | FBgn0051482 |
Length: | 195 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_500349.1 |
Gene: | F58E2.5 / 186521 |
WormBaseID: | WBGene00019049 |
Length: | 232 |
Species: | Caenorhabditis elegans |
Alignment Length: | 44 |
Identity: | 13/44 - (29%) |
Similarity: | 21/44 - (47%) |
Gaps: | 3/44 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MFLVNILIVLALCLLVLVIADLQEDHLNEHNRLREKHGSPPLTL 44
:.|:|.:..| .|.|..|...:|.||.:|.||.:..:...|:
Worm 21 LLLMNCITFL---FLNLASAIAHKDILNAYNNLRSEIANGTFTM 61
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2340 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1528782at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.