DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and F57B7.2

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001367203.1 Gene:F57B7.2 / 186438 WormBaseID:WBGene00010192 Length:330 Species:Caenorhabditis elegans


Alignment Length:170 Identity:45/170 - (26%)
Similarity:76/170 - (44%) Gaps:32/170 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DLQEDHLNEHNRLREKHGSPPLTLDDELTKGCEEYAKVLANNEKLEHSSSAGQNYGENLCMRS-- 83
            :.|...|:.||..|:::|:..|....||.:....:|..||:..::.:....|  .||||.::.  
 Worm   153 NFQRSCLDAHNECRQRYGNENLCWSTELAEMAHAWAVKLADRGRVLYPELPG--IGENLILKEAN 215

  Fly    84 -----QTPLQCVQDWYDEIADYDFEKPQFAMSTGHFTALVWKNAKKMGIGQAKDKKGYYW----- 138
                 .|..:.:|:|..|...:||:||::......|:.:|||:..::|..:       ||     
 Worm   216 EQSHLPTGQEVIQEWEKEAQFFDFDKPRWNPKCQRFSQVVWKDTTELGAAR-------YWNTANN 273

  Fly   139 ---VVARYYPPVNVN--GQFEENV------LPPIKGEGDE 167
               ||..|.|..|.|  |:|..||      :.||:..|.:
 Worm   274 CVAVVCFYRPAGNSNAPGEFASNVPSRDCSMSPIRNLGTQ 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 36/142 (25%)
F57B7.2NP_001367203.1 CAP_GAPR1-like 153..286 CDD:349401 36/141 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0001021
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.