DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and scl-24

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_507429.1 Gene:scl-24 / 184188 WormBaseID:WBGene00008575 Length:212 Species:Caenorhabditis elegans


Alignment Length:212 Identity:45/212 - (21%)
Similarity:74/212 - (34%) Gaps:74/212 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LALCLLVLVIADLQEDHLNE---------------HNRLRE--KHG------------SPPLTLD 45
            |.:.||.|..|...|.|.|.               ||:||.  .||            ...|:.:
 Worm     3 LIILLLALTAAAHAERHFNPQHQWNAEAIDNIVFIHNKLRNAASHGLWERYSISKSSNMQLLSWN 67

  Fly    46 DELTKGCEEYAKVLANNEKLEHSSSAGQN----YGENLCMRSQTPLQCVQDWYDEI--------- 97
            :.|....|        |||.....:..:|    .|:|:       .|...:.||:|         
 Worm    68 ESLVAEVE--------NEKYYCEPADNKNLPIKLGDNI-------YQYDVNTYDDIDGVGAMGSI 117

  Fly    98 --ADYDFEKPQFAMSTGHFTALVWKNAKKMG-IGQAKDK---KGYYW----VVARYYPPV-NVNG 151
              ..::..|.:...:......:::..:|.:| |.::.||   ||..:    |:.:|.||: |::.
 Worm   118 NKDTHNALKSEEKATKNRLRQMLYSKSKSIGCIYESCDKIDSKGINYNTRLVICKYSPPLENIDE 182

  Fly   152 QFEENVLPPIKGEGDEN 168
            |..:      |||...|
 Worm   183 QLFD------KGEPCSN 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 34/180 (19%)
scl-24NP_507429.1 CAP_euk 31..174 CDD:349399 28/157 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.