DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and C07A4.3

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_509707.2 Gene:C07A4.3 / 182352 WormBaseID:WBGene00007398 Length:207 Species:Caenorhabditis elegans


Alignment Length:165 Identity:51/165 - (30%)
Similarity:85/165 - (51%) Gaps:22/165 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IADLQEDHLNEHNRLREKHGSPPLTLDDELTKGCEEYAKVLANNEK-LEHSSSAGQNYGENL--- 79
            |.||::..::.||:.|..|.||.:|:|..||...::::..:|.::| |.|...:  .|||||   
 Worm    41 IKDLKKWIVHFHNKYRAHHSSPAVTVDSNLTNLAQKWSDEMAFHKKCLVHEQPS--KYGENLTSF 103

  Fly    80 -CMRSQTPLQC----VQDWYDEIADYDFEKPQFA----MSTGHFTALVWKNAKKMGIGQAKDKKG 135
             ..:..:|..|    :..:|.|  .|.|...:|.    ...||||.|:|||::|:|:|.:..|:|
 Worm   104 ASSKFPSPKTCAAALIHGFYTE--GYGFNYTRFNPGSWSKVGHFTQLLWKNSRKIGVGVSVAKRG 166

  Fly   136 ---YYWVVARYYPPVNV--NGQFEENVLPPIKGEG 165
               :.:|..:|.||.|:  :..:.:||..|....|
 Worm   167 TMYHVYVCIKYDPPGNMQTSEAYMDNVRAPKSTSG 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 45/143 (31%)
C07A4.3NP_509707.2 CAP_GAPR1-like 43..183 CDD:349401 45/143 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49417
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4761
orthoMCL 1 0.900 - - OOG6_101367
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2242
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.860

Return to query results.
Submit another query.