DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and C07A4.2

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_509706.2 Gene:C07A4.2 / 182351 WormBaseID:WBGene00007397 Length:417 Species:Caenorhabditis elegans


Alignment Length:174 Identity:52/174 - (29%)
Similarity:76/174 - (43%) Gaps:37/174 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IADLQEDHLNEHNRLREKHGSPPLTLDDELTKGCEEYAKVLANNEK-LEHSSSAGQNYGENLCMR 82
            |..|:|..::.||..|.|||:|.|..|..|....:.:|..||.::. |.|...  :.|||||...
 Worm   249 IPKLKEWLVSYHNVYRSKHGAPALISDSVLDSRGKRWADELAYHKGCLVHEQP--RTYGENLFFF 311

  Fly    83 SQTPL--------QCVQDWYDEIADYDFE--KPQFAMSTGHFTALVWKNAKKMGIGQAKDKKG-- 135
            ....|        ..:|.:|.|...|::.  :|.....|||||.|:|||::|:|:|.:..|..  
 Worm   312 GARHLPSPQTLAAAVIQSFYLEGIGYNYSSWRPMSFFKTGHFTQLIWKNSRKIGVGVSIVKSSSI 376

  Fly   136 ------------YYWVVARYYPPVNVNGQFE------ENVLPPI 161
                        :.:||.:|.|.    |.||      .||..|:
 Worm   377 RSPCVSSSPNMYFIYVVVKYDPA----GNFESHKAYLNNVERPV 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 45/152 (30%)
C07A4.2NP_509706.2 CAP_GAPR1-like 251..402 CDD:349401 46/156 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4761
orthoMCL 1 0.900 - - OOG6_101367
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.