DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and vap-1

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001024553.1 Gene:vap-1 / 181768 WormBaseID:WBGene00006886 Length:424 Species:Caenorhabditis elegans


Alignment Length:173 Identity:40/173 - (23%)
Similarity:69/173 - (39%) Gaps:30/173 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 QEDHLNEHNRLR-------EKHG------SPPLTLDDELTKGC--EEYAKVLANNEKLEHSSSAG 72
            :::.|:.||:||       |..|      :|......:|...|  |..|:..|.....:||:||.
 Worm   236 RQNFLDTHNKLRTSLAKGLEADGIAAGAFAPMAKQMPKLKYSCTVEANARTWAKGCLYQHSTSAQ 300

  Fly    73 Q-NYGENLCM---RSQTPLQCVQD----WYDEIADYD------FEKPQFAMSTGHFTALVWKNAK 123
            : ..||||.|   .:...:|..:|    |:.|:.|:.      ..:..|....||:|.:.|:...
 Worm   301 RPGLGENLYMISINNMPKIQTAEDSSKAWWSELKDFGVGSDNILTQAVFDRGVGHYTQMAWEGTT 365

  Fly   124 KMGIGQAKDKKGYYWVVARYYPPVNVNGQFEENVLPPIKGEGD 166
            ::|. ..::...:.:.|.:|.|..|...|.......|...:.|
 Worm   366 EIGC-FVENCPTFTYSVCQYGPAGNYMNQLIYTKGSPCTADAD 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 36/154 (23%)
vap-1NP_001024553.1 SCP 31..175 CDD:214553
SCP 234..386 CDD:214553 35/150 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.