DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and vap-2

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001300377.1 Gene:vap-2 / 181273 WormBaseID:WBGene00011462 Length:507 Species:Caenorhabditis elegans


Alignment Length:163 Identity:39/163 - (23%)
Similarity:66/163 - (40%) Gaps:33/163 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VIADLQEDH-LNEHNRLREK------------HGSPPLTLDDELTKGC--EEYAKVLANNEKLEH 67
            :::|:..:. |.:||..|.:            ...|..:...::...|  |.:|:..|||....|
 Worm   310 LVSDVTRNFTLEQHNFYRSRLAKGFEWNGETNTSQPKASQMIKMEYDCMLERFAQNWANNCVFAH 374

  Fly    68 SSSAGQ-NYGENLCMRS-QTP------LQCVQDWYDEIADY-----DFEKPQF----AMSTGHFT 115
            |:...: |.|:||.|.| ..|      ...|:.|:.|:.::     :...|:.    ..:.||:|
 Worm   375 SAHYERPNQGQNLYMSSFSNPDPRSLIHTAVEKWWQELEEFGTPIDNVLTPELWDLKGKAIGHYT 439

  Fly   116 ALVWKNAKKMGIGQAKDKKGYYWVVARYYPPVN 148
            .:.|....::|.|.|...|..| ||..|.|..|
 Worm   440 QMAWDRTYRLGCGIANCPKMSY-VVCHYGPAGN 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 39/160 (24%)
vap-2NP_001300377.1 SCP 104..253 CDD:214553
SCP 315..468 CDD:214553 36/153 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.