DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and Crispld2

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_612527.2 Gene:Crispld2 / 171547 RGDID:620860 Length:497 Species:Rattus norvegicus


Alignment Length:212 Identity:55/212 - (25%)
Similarity:82/212 - (38%) Gaps:68/212 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LVNILIVLALCLLV---------------------------------LVIADLQEDHLNEHNRLR 34
            |:|.::.:.|.|||                                 :.::|.|| .|..||:||
  Rat     4 LLNNMVPVGLALLVCGVQAFFLPNTMSLERLLSKYQHTEPHSRVRRAIPMSDRQE-ILMLHNKLR 67

  Fly    35 EKHGSPP-----LTLDDELTKGCEEYAKVLANNEKLEHS-SSAGQNYGENLCM---RSQTPLQCV 90
            .:...|.     :|.|:||    |..|...|.....||. :|...:.|:||.:   |.::|...|
  Rat    68 GQVYPPASNMEYMTWDEEL----ERSAAAWAQRCLWEHGPASLLVSIGQNLAVHWGRYRSPGFHV 128

  Fly    91 QDWYDEIADYDF-----------EKPQFAMSTGHFTALVWKNAKKMGIG----QAKDKKGYYW-- 138
            |.||||:.||.:           |:...||.| |:|.:||....|:|..    ::....|..|  
  Rat   129 QSWYDEVKDYTYPYPHECNPWCPERCSGAMCT-HYTQMVWATTNKIGCAVHTCRSMSVWGDIWEN 192

  Fly   139 ---VVARYYPPVNVNGQ 152
               :|..|.|..|..|:
  Rat   193 AVYLVCNYSPKGNWIGE 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 47/156 (30%)
Crispld2NP_612527.2 SCP_euk 56..201 CDD:240180 44/150 (29%)
LCCL 286..370 CDD:128866
LCCL 389..487 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.