DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and CRISP1

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001122.2 Gene:CRISP1 / 167 HGNCID:304 Length:249 Species:Homo sapiens


Alignment Length:168 Identity:36/168 - (21%)
Similarity:58/168 - (34%) Gaps:66/168 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILIVLALCLLVL--------------VIADL---QEDHLNEHNRLREKHGSPPLTLDDELTKGCE 53
            :.:|.|.|||.:              ::.||   ||:.:|.||.||.:...|             
Human     7 LFLVAAACLLPMLSMKKKSARDQFNKLVTDLPNVQEEIVNIHNALRRRVVPP------------- 58

  Fly    54 EYAKVLANNEKLEHSSSAGQN------------------------YGENLCMRSQTPL---QCVQ 91
                 .:|..|:..|..|.||                        .|||:.|.|. |:   ..:.
Human    59 -----ASNMLKMSWSEEAAQNARIFSKYCDMTESNPLERRLPNTFCGENMHMTSY-PVSWSSVIG 117

  Fly    92 DWYDEIADY---DFEKPQFAMSTGHFTALVWKNAKKMG 126
            .||.|...:   ::......::|.|:|.:||..:..:|
Human   118 VWYSESTSFKHGEWTTTDDDITTDHYTQIVWATSYLIG 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 31/139 (22%)
CRISP1NP_001122.2 SCP_CRISP 39..177 CDD:240183 29/136 (21%)
Crisp 195..249 CDD:285731
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.