DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and GLIPR2

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001273942.1 Gene:GLIPR2 / 152007 HGNCID:18007 Length:169 Species:Homo sapiens


Alignment Length:142 Identity:72/142 - (50%)
Similarity:90/142 - (63%) Gaps:7/142 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LNEHNRLREKHGSPPLTLDDELTKGCEEYAKVLANNEKLEHS--SSAGQNYGENLCMRS--QTPL 87
            |..||..|:|||.|||.|...|.:..::|::.||:...|:||  ||.|| .||||...|  ||..
Human    29 LKAHNEYRQKHGVPPLKLCKNLNREAQQYSEALASTRILKHSPESSRGQ-CGENLAWASYDQTGK 92

  Fly    88 QCVQDWYDEIADYDFEKPQFAMSTGHFTALVWKNAKKMGIGQAKDKKGYYWVVARYYPPVNV--N 150
            :....||.||.:|:|::|.|...||||||:||||.||||:|:|....|..:|||||:|..||  .
Human    93 EVADRWYSEIKNYNFQQPGFTSGTGHFTAMVWKNTKKMGVGKASASDGSSFVVARYFPAGNVVNE 157

  Fly   151 GQFEENVLPPIK 162
            |.||||||||.|
Human   158 GFFEENVLPPKK 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 60/125 (48%)
GLIPR2NP_001273942.1 SCP_GAPR-1_like 23..154 CDD:240182 60/125 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157089
Domainoid 1 1.000 106 1.000 Domainoid score I6623
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 132 1.000 Inparanoid score I4629
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49417
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0001021
OrthoInspector 1 1.000 - - oto90691
orthoMCL 1 0.900 - - OOG6_101367
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2242
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.