DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and GLIPR1L2

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001257325.1 Gene:GLIPR1L2 / 144321 HGNCID:28592 Length:344 Species:Homo sapiens


Alignment Length:150 Identity:33/150 - (22%)
Similarity:61/150 - (40%) Gaps:32/150 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LIVLALCLLVLVI---------------ADLQEDHLNEHNRLRE---KHGSPP--LTLDDELTKG 51
            ::.|.||.|.|::               .|...:::|.||.||.   ..||..  :|.|..|::.
Human    23 VLKLRLCELWLLLLGSSLNARFLPDEEDVDFINEYVNLHNELRGDVIPRGSNLRFMTWDVALSRT 87

  Fly    52 CEEYAK-------VLANNEKLEHSSSAGQNYGENLCMRSQ---TPLQCVQDWYDEIADYDFEKPQ 106
            ...:.|       :...:.::.|....|  .|||:.:..:   |....::.|:.|...|:||...
Human    88 ARAWGKKCLFTHNIYLQDVQMVHPKFYG--IGENMWVGPENEFTASIAIRSWHAEKKMYNFENGS 150

  Fly   107 FAMSTGHFTALVWKNAKKMG 126
            .:....::..|||.::.|:|
Human   151 CSGDCSNYIQLVWDHSYKVG 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 27/120 (23%)
GLIPR1L2NP_001257325.1 SCP_GLIPR-1_like 52..195 CDD:240185 27/120 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..344
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.