DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and LOC101883528

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_005162473.1 Gene:LOC101883528 / 101883528 -ID:- Length:261 Species:Danio rerio


Alignment Length:207 Identity:50/207 - (24%)
Similarity:79/207 - (38%) Gaps:62/207 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLVLVIADLQEDHL----NEHNRLREKHGSP------PLTLDDELTKGCEEYAK--VLANNEKLE 66
            :|.|.:..|.|..:    :.||.||.: ..|      .:..|:.:....|.||.  :..:|..||
Zfish    15 ILSLAVGQLTEQEILNIVDLHNELRSQ-VQPSAAFMQKVVWDETIRLVAEGYAAKCIWDHNPDLE 78

  Fly    67 HSSSAGQNYGENLCMRSQ--TPLQCVQDWYDEIADYDFEKPQFA--MSTGHFTALVWKNAKKMGI 127
            |.:     .||||.:.:.  ...:.|.||::|..||::.....|  ...||:|.|||.|..|:|.
Zfish    79 HLT-----MGENLFVGTGPFNATKAVMDWFNENLDYNYNTNDCAEDKMCGHYTQLVWANTTKIGC 138

  Fly   128 GQAKDKKGYY-------------WVVARYYPPVNVNGQ--FE-------------------ENVL 158
            .      .|:             .::..|||..|:.||  :|                   ||:.
Zfish   139 A------SYFCDTLEKLHFEKATLLICDYYPQGNIEGQKPYESGESCSKCPEECENNICVMENLF 197

  Fly   159 PPIKGEGDENGQ 170
            ||.:....::.|
Zfish   198 PPFEDTDPKSTQ 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 39/156 (25%)
LOC101883528XP_005162473.1 SCP_HrTT-1 28..162 CDD:240186 34/145 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.