DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and CG42764

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001189140.1 Gene:CG42764 / 10178963 FlyBaseID:FBgn0261832 Length:232 Species:Drosophila melanogaster


Alignment Length:229 Identity:64/229 - (27%)
Similarity:91/229 - (39%) Gaps:50/229 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFLVNILIVLALCLLVLVIADLQEDHLNEHNRLREKHGSPPLTLDDELTKGCEEYAKVLA----- 60
            |.|....:....||...||.....|..|:|   |.....|.|...|||:...||||..||     
  Fly     1 MLLFLFFLAFRPCLGYNVIRSEAYDAHNDH---RRTWVVPELIESDELSHDAEEYAIHLATLNIP 62

  Fly    61 ----------NNEKLEH-----SSSAGQNYGENLC--MRSQTPLQCVQDWYDE-IADYDFEKPQF 107
                      .|.:::|     |......|.||:|  :|:    :||..|..| .|.|...|.:.
  Fly    63 DQILYETAKDRNIRVDHLDYPLSEPENDFYTENICEFIRN----ECVYYWASEGAASYGIAKERR 123

  Fly   108 A----MSTGHFTALVWKNAKKMGIGQA-KD---KKGYYWVVARYYPPVNVNGQFEENV------- 157
            .    .....|:|:.||:..:||:|.| ||   |.|...:|.||.|..|..|::.||:       
  Fly   124 TKVEQSLADKFSAITWKSTTEMGVGWAPKDRSKKGGRKILVVRYSPAGNQPGEYAENIGDTEFLE 188

  Fly   158 --LPPIKGEGD--ENGQGNLNRFQVDNIPIIVML 187
              ..|.:.:.|  .||...|: :.|.::.|.:.|
  Fly   189 YFKMPTREDPDRWRNGSARLS-YGVVDVQICISL 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 46/158 (29%)
CG42764NP_001189140.1 SCP 22..172 CDD:294090 46/156 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.