DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and CG42780

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster


Alignment Length:172 Identity:42/172 - (24%)
Similarity:60/172 - (34%) Gaps:49/172 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LNEHNRLREKHGSPPLTL--------DDELTKGCEEYAKVLA-----------NNEKLEHSSSAG 72
            :..||.:|:|..|....:        ..|..|..|:.|.:.|           |.||...|   |
  Fly    66 IKAHNLVRQKWASGKAKIKWTACKMAKMEWNKDLEKLAILNAKTCLMGHDECHNTEKFRLS---G 127

  Fly    73 QN---YGENLCMRSQTPL---------QCVQDWYDEIADY---DFEK--PQFAMSTGHFTALVWK 120
            ||   .|.:....::|.:         ..||.|..|..|.   |.:|  |......||.|.|:.:
  Fly   128 QNLFAMGFSHARITKTKMNMTLSMLFEMAVQKWAGEEKDITAEDLKKTTPNPPEVIGHLTVLINE 192

  Fly   121 NAKKMGIGQAKDKKGYYWVVARY-----YPPVNVNGQ--FEE 155
            .:..:|.|......|   .:.||     |...||.|:  :||
  Fly   193 KSNAVGCGLVAYNLG---EIRRYNLACNYAYTNVIGERVYEE 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 37/162 (23%)
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 36/158 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455019
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.