DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and LOC100536500

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_017207056.1 Gene:LOC100536500 / 100536500 -ID:- Length:245 Species:Danio rerio


Alignment Length:201 Identity:41/201 - (20%)
Similarity:71/201 - (35%) Gaps:47/201 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LIVLALCLLVLV--------------IADLQEDHLNEHNRLREK-HGSPPLTLDDELTKGCEEYA 56
            :..|.:|.|..:              ::.:|::.::.||..|.. ..|....|....:....|.|
Zfish    10 MFALVICFLGFLHMSAACSVTGVCTELSSVQQEIVDVHNAFRRAVQPSASNMLKMSWSDAVAESA 74

  Fly    57 KVLANNEKLEHSSSA-----GQNYGENLC----MRSQTPLQCVQDWYDEIADYDFEKPQF-AMST 111
            :...|...:.|...:     |...||||.    :.|.|.:  |..|:.|:.:|.:..... ..:|
Zfish    75 RGWINKCNMTHGPPSSRMLNGYEMGENLFKATGISSWTSV--VDAWHSEVNNYKYPIGSINGQAT 137

  Fly   112 GHFTALVWKNAKKMGIGQAKDKKGYYWVVARYY--------PPV-----------NVNGQFEENV 157
            ||:|.:||.::.::|....:....|:: ...||        ||.           |.......|.
Zfish   138 GHYTQVVWYSSYEVGCAVTQCGSNYFY-GCHYYRAGNFRTVPPYSLGSPCASCPNNCEDNLCTNA 201

  Fly   158 LPPIKG 163
            .|.|.|
Zfish   202 CPYING 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 33/157 (21%)
LOC100536500XP_017207056.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.