DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and LOC100497187

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_017945658.1 Gene:LOC100497187 / 100497187 -ID:- Length:208 Species:Xenopus tropicalis


Alignment Length:140 Identity:63/140 - (45%)
Similarity:90/140 - (64%) Gaps:2/140 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 QEDHLNEHNRLREKHGSPPLTLDDELTKGCEEYAKVLANNEKLEHSSSAGQNYGENLCMRSQTPL 87
            |...|..||:.|:||..||:.|:.||:|..:.:|..|.:..|::||.:.|:|...:...|.:|..
 Frog    68 QTQFLEAHNKYRKKHNVPPMRLNAELSKSAQTWANHLLSINKMQHSGAGGENLYYSYSSRGRTLA 132

  Fly    88 --QCVQDWYDEIADYDFEKPQFAMSTGHFTALVWKNAKKMGIGQAKDKKGYYWVVARYYPPVNVN 150
              ..|..||:|:.|||:.||.|..:|||||.:|||::|::|:|.|.|.||.::||.||.||.||.
 Frog   133 GNVAVDAWYNEVKDYDYNKPGFKAATGHFTQVVWKDSKELGVGVATDGKGTFYVVGRYSPPGNVI 197

  Fly   151 GQFEENVLPP 160
            |||:||||.|
 Frog   198 GQFQENVLRP 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 53/127 (42%)
LOC100497187XP_017945658.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H130828
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0001021
OrthoInspector 1 1.000 - - otm48948
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.