DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and crisp2-like

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001188271.2 Gene:crisp2-like / 100495843 -ID:- Length:207 Species:Xenopus tropicalis


Alignment Length:135 Identity:36/135 - (26%)
Similarity:54/135 - (40%) Gaps:25/135 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 HNRLREKHGSPPLTLDDELTKGCEEYAKVLANNEK----LEHSSSAGQ------NY--GENLCMR 82
            ||.||.   |...|..|.|.......|.:.|.|..    ::|||:..:      ||  |||:.:.
 Frog    42 HNLLRR---SVDPTAKDMLKMEWSPGAALNAQNAAAKCVMQHSSATERQIQDPFNYVCGENIYVT 103

  Fly    83 SQTP--LQCVQDWYDEIADYDF-EKPQFAMSTGHFTALVWKNAKKMGIGQAKDKKGYYWVVARYY 144
            :..|  ...|..|::|..|:.: ..|......||:|.:.|.....:|.|.|       :....||
 Frog   104 TAKPDWAAAVNSWFNERNDFTYGVGPNSDKMIGHYTQVAWAKTYLLGCGLA-------FCPGNYY 161

  Fly   145 PPVNV 149
            |.|::
 Frog   162 PYVSI 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 36/133 (27%)
crisp2-likeNP_001188271.2 SCP 33..171 CDD:320774 36/135 (27%)
Crisp 189..>205 CDD:312162
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.