DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and crispld1

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_002937123.2 Gene:crispld1 / 100490431 XenbaseID:XB-GENE-989389 Length:514 Species:Xenopus tropicalis


Alignment Length:259 Identity:63/259 - (24%)
Similarity:95/259 - (36%) Gaps:97/259 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILIVLALCLLVLVIAD------LQEDHLNE--------------------------HNRLREKHG 38
            :|:.:|..::.|||.:      |.|.:::|                          ||:||.:..
 Frog    13 VLLFIAQSVVTLVIPNATQLEGLLEKYMDEDGEWWTAKHRGKRAITESDMKLILDLHNKLRGEVY 77

  Fly    39 SPPLTL-----DDELTKGCEEYAKVLANNEKLEHSSS-----AGQNYGENLCMRSQTPLQCVQDW 93
            .|...:     |.||.:..|.:|:...    .||..:     .|||.|.: ..|.:.|...||.|
 Frog    78 PPASNMEFMIWDVELERSAEAWAETCL----WEHGPADLLPVIGQNLGAH-WGRYRPPTYHVQAW 137

  Fly    94 YDEIADYDFEKPQ-------FAMS---TGHFTALVWKNAKKMGI-----------GQAKDK---- 133
            |||:.||.|..||       |..|   ..|:|.|||..:.::|.           ||...|    
 Frog   138 YDEVRDYTFPYPQECDPYCPFRCSGPVCTHYTQLVWATSSRIGCAINLCHNMNVWGQIWPKAIYL 202

  Fly   134 ------KGYYWVVARY---YP----PVNVNGQFEENV-----------LPPIKGEGDE-NGQGN 172
                  ||.:|..|.|   :|    |.:..|..::|:           ||..:.|.:| .||.:
 Frog   203 VCNYSPKGNWWGHAPYKHGHPCSACPPSYGGGCKDNLCYKDGSDLHYPLPEPEEETNEIEGQSS 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 50/207 (24%)
crispld1XP_002937123.2 CAP_CRISPLD1 62..207 CDD:349407 40/149 (27%)
LCCL 304..388 CDD:128866
LCCL 407..506 CDD:367672
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.