DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and LOC100490275

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_031754789.1 Gene:LOC100490275 / 100490275 -ID:- Length:291 Species:Xenopus tropicalis


Alignment Length:179 Identity:46/179 - (25%)
Similarity:71/179 - (39%) Gaps:34/179 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFLVNILIVLALCLLVLV-----------IADLQEDHLNEHNRLREKHGSPP-----LTLDDELT 49
            |:|..:::|:::|....:           :.||    :|.||.:|.:.|...     ::.|..|.
 Frog     1 MWLPQLMLVVSVCGARQLDPTPAYNNERFVTDL----VNAHNDIRNEFGKQAANMLHMSWDVGLA 61

  Fly    50 K-------GCEEYAKVLANNEKLEHSSSAGQNYGENLCMRSQTPL-QCVQDWYDEIADYDFEKP- 105
            |       .|::......|.|.:   ....:..||||.|.....: :.|.:|..|...||.:.. 
 Frog    62 KLAQAWTINCKKVPNPHLNKESI---YPRFKQIGENLYMGPSIDIFKIVTNWGLEGNFYDLKNNS 123

  Fly   106 -QFAMSTGHFTALVWKNAKKMGIGQAK-DKKGYYWVVARYYPPVNVNGQ 152
             |......|||.:||.|..|:|.|.|. ..|..|.|...|.|..|:.||
 Frog   124 CQPGKDCSHFTQIVWANTYKVGCGAAYCAHKVAYVVSCTYGPRGNLLGQ 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 39/143 (27%)
LOC100490275XP_031754789.1 CAP 28..167 CDD:412178 39/145 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.