DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and crispld1a

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_001920421.2 Gene:crispld1a / 100149104 ZFINID:ZDB-GENE-090612-1 Length:508 Species:Danio rerio


Alignment Length:198 Identity:57/198 - (28%)
Similarity:80/198 - (40%) Gaps:58/198 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LVIADLQEDHLNEHNRLREKHGSPP-----LTLDDELTKGCEEYAKVLANNEKLEHSSSA----- 71
            :..:|:|. .|:.||:||.:...|.     :..|:||.:..||:|:...    .||..:.     
Zfish    62 ITASDMQA-ILDLHNKLRGQVYPPASNMEYMVWDNELERSAEEWAETCL----WEHGPAGLLPQI 121

  Fly    72 GQNYGENLCMRSQTPLQCVQDWYDEIADYDFEKPQ-------FAMS---TGHFTALVWKNAKKMG 126
            |||.|.: ..|.:.|...||.||||:.||.|..||       |..|   ..|:|.|||..:.::|
Zfish   122 GQNLGVH-WGRYRPPTSHVQAWYDEVKDYSFPYPQECNPHCPFRCSGPVCTHYTQLVWATSSRIG 185

  Fly   127 I-----------GQAKDK----------KGYYWVVARY--------YPPVNVNGQFEENVLPPIK 162
            .           ||...|          ||.:|..|.|        .|| :..|...||:.  .|
Zfish   186 CAINVCYNMNVWGQIWAKAVYLVCNYSPKGNWWGYAPYKHGTSCSACPP-SYGGVCRENLC--YK 247

  Fly   163 GEG 165
            |:|
Zfish   248 GDG 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 51/176 (29%)
crispld1aXP_001920421.2 SCP_euk 68..212 CDD:240180 43/149 (29%)
LCCL 298..381 CDD:128866
LCCL 401..500 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.